GrainGenes Home

 
GrainGenes Tools GrainGenes Database (the new MySQL version or the classic ACEDB one), sequence searches, map viewers.
  Browse GrainGenes
  Quick Queries
  Advanced Queries
  GrainGenes Classic
  BLAST
  CMap
  GBrowseBarley Bin Map
GrainMaps
Rice chromosomes vs. cereal genes
Wheat Physical EST Maps
Species PortalsData focused on individual crop species.
  Avena Ave.
  Barley Blvd.
Query Data Types Datasets of particular interest in GrainGenes SQL.
  Maps             An organized, annotated table of contents of the GrainGenes maps.
  Genetic MarkersProbes, primers and genes, with links to mapped locations.
  Sequences
  QTLs
  Gene ExpressionSequences from the Barley1 GeneChip, with links to BarleyBase.
  Colleagues
Web ResourcesBesides the Database, the GrainGenes Website includes a large array of other data resources, classified by topic here. See also the "Search Website" button above.
  Genomics
  Mapping
  Germplasm
  Pathology
  Taxonomy
  Publications
  Links to related sites
User ServicesJob openings, conference announcements, how to contribute your data, joining the grains mailgroup, ...
  What's New
  Employment
  Calendar
  Submit Data
  Database Information How to join the grains mailgroup.
About the GrainGenes Website and Database.
Mirror SitesOther Internet sites serving a copy of the GrainGenes Database and/or the GrainGenes Website.
GrainGenes  GrainGenes RSS Feed Link
Query (optional)   in Class 

GrainGenes Protein Report: X14107_2.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
X14107_2.protseq
Peptide
MATQTVEDSSKPRPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALF
AIFLSIILEIYNSSILLDGILTN
From Database
GenBank
Corresponding DNA
X14107_2.cds

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.