Query (optional)   in Class  

GrainGenes Protein Report: AF155932_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
AF155932_1.protseq
Peptide
IGVCYGVTGNNLPSRSDVVQLYRSKGITDMRIYFADGQALSALRNSGIGL
VMDIGNDQLGKIAGSASNAAAWVRDNVQRYQGLKIKYIVAGNEIQGGDTG
RIVPAIRNLNAALSAAGLGGIKVSTAIRFDAVANSFPPSAGVFAQSYMTD
VARLLASTGAPLLANIYPYFSYRDNPRDIQLNYATFRPGTTVRDSKSGLT
YTNLFDAMVDAVHAALEKAGAASVKVVVSESGWPKEGGTGASVDNARAYN
QGLIDHVGGGTPKKRGALETYVFAMFDENQKTGAGTEKHFGLFNPDKSPA
YPIRF
From Database
GenBank
Corresponding DNA
AF155932_1.cds