Query (optional)   in Class  

GrainGenes Protein Report: AF287722_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
AF287722_1.protseq
Peptide
RDRLGDEDVPAYMFKEVARLDPEPVLFVNDYNVECGNDPNATPEKYAEQV
AWLQSCGAVVRGIGLQGHVQNPVGEVICAALDRLAKTGVPIWFTELDVPE
YDVGLRAKDLEVVLREAYAHPAVEGIVFWGFMQGTMWRQNAWLVDADGTV
NEAGQMFLNLQKEWKTDARGNFDGDGNFKFRGFYGRYVVEVTTAKRKQML
NTSTVEKGDNTPVVVDLADA
From Database
GenBank
Corresponding DNA
AF287722_1.cds