Query (optional)   in Class  

GrainGenes Protein Report: AL356014_29.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
AL356014_29.protseq
Peptide
MVRKEDVDFYCGFSRKELQSLCKKYNLPANRSSSDMAESLASYFEKNNLN
PVSFGVPGNQDSSATTSRAPAIRTWNVKRDSYGNKLDVPREDYVQGAVAR
EPGIILGNNTPYQERNGNDGLIDFTSAPPYMRKLNEKGPTANSKRADSRL
ENRMRDVDSGDNPSSSSFEFHVSLEEGISLSVDLNFNPSDWINSMRDEVN
VCDSMRRRKSPHSDLGITECKKQKSSGQDTDGHVRRESSLSPPMKDNAHL
PSDHHPNGERSLASSAIEPCNRIKESSDTCKEKSGLNLSIPDSSGPCQIA
SSCVESYSKSCCVNPVDLDCIIPPGKKLASESDMVAAEQNHSAGDLLVEI
PKNPSMESFQIVGNSSTVICPRGAGSELSSSEAEAYHSNQPCSPRKTSRS
STISSPEFIIDRESTSYSESFKFRCNGGKSLPPNTEEQEKSEVLSEQARS
E
From Database
GenBank
Corresponding DNA
AL356014_29.cds