Query (optional)   in Class  

GrainGenes Protein Report: M10144_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
M10144_1.protseq
Peptide
MAATTMSLSSSSFAGKAVKNLPSSALIGDARVNMRKTAAKAKQVSSSSPW
YGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEV
IHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNP
SLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGL
AERPQAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEDLADHIADP
VNNNAWLIATNFVPGK
From Database
GenBank
Corresponding DNA
M10144_1.cds