Query (optional)   in Class  

GrainGenes Protein Report: M11074_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
M11074_1.protseq
Peptide
MKTFLILALLAIVATTATTAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQF
LGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFLQPQLPYSQPQPFRPQQPY
PQPQPQYSQPQQPISQQQQQQQQQQQQQQQQQQQIIQQILQQQLIPCMDV
VLQQHNIVHGKSQVLQQSTYQLLQELCCQHLWQIPEQSQCQAIHNVVHAI
ILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQAQGSVQPQQL
PQFEEIRNLARK
From Database
GenBank
Corresponding DNA
M11074_1.cds