Query (optional)   in Class  

GrainGenes Protein Report: U00966_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
U00966_1.protseq
Peptide
MGSATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVY
VLVV
From Database
GenBank
Corresponding DNA
U00966_1.cds