Query (optional)   in Class  

GrainGenes Protein Report: Y07550_1.protseq

[ Submit comment/correction ]

Protein
Y07550_1.protseq
Peptide
MHPSLQTILLSALFTTAHAQQACSSKPETHPPLSWSRCSRSGCRSVQGAV
TVDANWLWTTVDGSQNCYTGNRWDTSICSSEKTCSESCCIDGADYAGTYG
VTTTGDALSLKFVQQGPYSKNVGSRLYLMKDESRYEMFTLLGNEFTFDVD
VSKLGCGLNGALYFVSMDEDGGMKRFPMNKAGAKFGTGYCDSQCPRDVKF
INGMANSKDWIPSKSDANAGIGSLGACCREMDIWEANNIASAFTPHPCKN
SAYHSCTGDGCGGTYSKNRYSGDCDPDGCDFNSYRLGNTTFYGPGPKFTI
DTTRKISVVTQFLKGRDGSLREIKRFYVQNGKVIPNSVSRVRGVPGNSIT
QGFCNAQKKMFGAHESFNAKGGMKGMSAAVSKPMVLVMSLWDDHNSNMLW
LDSTYPTNSRQRGSKRGSCPASSGRPTDVESSAPDSTVVFSNIKFGPIGS
TFSRGK
From Database
GenBank
Corresponding DNA
Y07550_1.cds

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.