Query (optional)   in Class  

GrainGenes Protein Report: A20727_1.AA

Protein
A20727_1.AA
Peptide
MAAATTTTSRPLLLSRQQAAASSLQCRLPRRPGSSLFAGQGQASTPNVRC
MAVVDTASAPAPAAA