Query (optional)   in Class  

GrainGenes Protein Report: A37987_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
A37987_1.protseq
Peptide
AVTTLLLMVNEATRFQTVSGFVAGLLHPKAVEKKSGKIGNEMKAQVNGWQ
DLSAALLKTDVKPPPGKSPAKFTPIEKMGVRTAEQAAATLGILLFVEVPG
GLTVAKALELFHASGGK
From Database
GenBank
Corresponding DNA
A37987_1.cds