Query (optional)   in Class  

GrainGenes Protein Report: A39655_1.AA

Protein
A39655_1.AA
Peptide
MAARLMLVAALLCAAAAMATAQQANNVRATYHYYRPAQNNWDLGAPAVSA
YCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAQIT
ARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD