Query (optional)   in Class  

GrainGenes Protein Report: A39655_1.protseq

Protein
A39655_1.protseq
Peptide
MAARLMLVAALLCAAAAMATAQQANNVRATYHYYRPAQNNWDLGAPAVSA
YCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAQIT
ARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD
From Database
GenBank
Corresponding DNA
A39655_1.cds