Query (optional)   in Class  

GrainGenes Protein Report: A48280_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
A48280_1.protseq
Peptide
MGSHGKPPLPYAYKPLPSDAADGKRTGCMRWSACATVLTASAMAVVVVGA
TLLAGLRMEQAVDEEAAAGGFPWSNEMLQWQRSGYHFQTAKNYMSDPNGL
MYYRGWYHMFYQYNPVGTDWDDGMEWGHAVSRNLVQWRTLPIAMVADQWY
DILGVLSGSMTVLPNGTVIMIYTGATNASAVEVQCIATPADPNDPLLRRW
TKHPANPVIWSPPGVGTKDFRDPMTAWYDESDETWRTLLGSKDDHDGHHD
GIAMMYKTKDFLNYELIPGILHRVVRTGEWECIDFYPVGRRSSDNSSEML
HVLKASMDDERHDYYSLGTYDSAANTWTPIDPELDLGIGLRYDWGKFYAS
TSFYDPAKNRRVLMGYVGEVDSKRADVVKGWASIQSVPRTVALDEKTRTN
LLLWPVEEIETLRLNATELTDVTINTGSVIHIPLRQGTHARHAEASFHLD
ASAVAALNEADVGYNCSSSGGAVNRGALGPFGLLVLAAGDRRGEQTAVYF
YVSRGLDGGLHTSFCQDELRSSRAKDVTKRVIGSTVPVLDGEALSMRVLV
DHSIVQGFDMGGRTTMTSRVYPMESYQEARVYLFNNATGASVTAERLVVH
EMDSAHNQLSNEDDGMYLHQVLESRH
From Database
GenBank
Corresponding DNA
A48280_1.cds