Query (optional)   in Class  

GrainGenes Protein Report: A82382_1.protseq

Protein
A82382_1.protseq
Peptide
LPPGFRFHPTDEEVVTHYLTRKVLRESFSCQVITDVDLNKNEPWELPGLA
KMGEKEWFFFAHKGRKYPTGTRTNRATKKGYWKATGKDKEIFRGKGRDAV
LVGMKKTLVFYTGRAPSGGKTPWVMHEYRLEGELPHRLPRTAKDDWAVCR
VFNK
From Database
GenBank
Corresponding DNA
A82382_1.cds