Query (optional)   in Class  

GrainGenes Protein Report: EF012227_1.AA

Protein
EF012227_1.AA
Peptide
MEEVYPSNSKTKAGQMAAEAIAARIRSLGQSQSRRWNALGASLASPSSDT
TATIVCLSTSTSARPAAATGPMVAPSATSPSVVAAASPSARGPPTPTSSA
WPPHRNPPLSCPLRPAQGRTLRTSSRRLCLLVLRFKAAFPLPPLGHHRRP
TRRRGCPLVGRRRFKTCKEGVQEGFLMAASVRTMATTMVVQPLDQAMGCG
WRGQRCHLSFQFRCRSMAISWLVELEYVPQLLQYIKGPLARTEIPAWRAR
WGSNGNHRLALTIPSNKWRIHSIVKRCPAMRRWATANQQYDSGGDDNNGG
SSRDCYWITNGGSIPWQSLLTSTSLM