Query (optional)   in Class  

GrainGenes Protein Report: EF077434_1.protseq

Protein
EF077434_1.protseq
Peptide
SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADIN
NEWCRCGDLSSMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKV
PIPNPSGDRAGVCYWAAYPDV
From Database
GenBank
Corresponding DNA
EF077434_1.cds