Query (optional)   in Class  

GrainGenes Protein Report: EF077437_1.AA

Protein
EF077437_1.AA
Peptide
SGPWSWCDPATGYKVSTLTGCRAMVKLQCVGSQVPEAVLRDCCQQLADIN
NEWCRCGDLSSMLRSVYQELGVREGKEVLPGCLKEVMKLTAASVPEVCKV
PIPNPSGDRAGVCYWAAYPDV