Query (optional)   in Class  

GrainGenes Protein Report: EF051701_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
EF051701_1.protseq
Peptide
MAKRLVHFVAVVVALVALTVAEGEASGQLQCERELQERELKACQQVMDQQ
LRDISPKCHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQSIFW
GIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSVQEQQGY
YSTSPQQPGQWQQPEQGQPGYYPTSLQQPGQLQQPAQGQQGQQSGQGQQG
QQPGQGQPGYYPTSLQLQPGQLQQPAQGQQGQQPGQGQQGQQSGQGKQSG
QGQQGQQPGQGQQGQQLGQGQGYYPTSLQQSGQGQPGYYPTFLQQPGQWQ
SGYYPTSPQQPGQGQQPEQLQQPAQGQQPGQGQQGQQPAQGQQGQQGQQP
AQGQQGQQPAQGQQGQQGQQPAQGQQGQQGQQPAQGQQPGQGQLGYYPTS
PQQSGQGQPGYYPTSSQQPGQSQQPGQGKQGQQLGQGQQAQQPGQGQQPG
QGQSGYYPTSSQQSGQGQPGYYLTSPQQPGQGQQPGQLQQSAQGQEGQQP
GQGQQGQQPGQGQQGQLPGQGQQGQQPGQGQPGYYPTSPQESGQGQQPGQ
WQQSGQGQPGYYPTSPLQPGQGQPGYNPTSPQQPGQGQQPGQLQQPTQEQ
QGQQLAQGQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQEQQPAQGQQG
QQPAQGQQGQQPGQGQQPGQRQPGYYPTSPQESGQGQQPGHWQQPGQGQP
GYYLTSLLQPGQGQQGYYPTSLQQLGQGQQPGQWQQSGQGQQGYYTTSPQ
LSGQGQQLGQWLQLGQGQQPGQWLQPGQGQQGYYPTSPQQSGQGQQPGQW
LQPGQGQQVYYPTSPQQPGQGQQSGQGQQGYYSSYHVSAEHQAASLKVAK
AQQLAAQLPAMCRLEGGDALSASQ
From Database
GenBank
Corresponding DNA
EF051701_1.cds