Query (optional)   in Class  

GrainGenes Protein Report: EF077427_1.AA

[ Printable Version ]  [ Submit comment/correction ]

Protein
EF077427_1.AA
Peptide
SGPWSWCDPATGYKVSTLTGCRAMVKLQCVGSQVPEAVLRDCCQQLADIN
NEWCRCGDLSSMLRSVYQELGVREGKEVLPGCLKEVMKLTAASVPEVCKV
PIPNPSGDRAGVCYWAAYPDV