Query (optional)   in Class  

GrainGenes Protein Report: EF095077_1.AA

[ Printable Version ]  [ Submit comment/correction ]

Protein
EF095077_1.AA
Peptide
ELMRVRFSKTRFGEHQAENWWKENREKVYERYNVRTSQRASSAASTHSA