Query (optional)   in Class  

GrainGenes Protein Report: FB802243_1.AA

Protein
FB802243_1.AA
Peptide
MALLCSALSNSTHPSFRSHIGANSENLWHLSADPAQKSKRRCNLTLSSRA
ARISSALESAKQVKPWQVPKRDWFPPEFMFGAASAAYQIEGAWNEGGKGP
SSWDNFCHSHPDRIMDKSNADVAANSYYMYKEDVRMLKEIGMDSYRFSIS
WPRILPKGTLDGGINHEGIQYYNDLLDCLIENGIKPYITLFHWDTPQALA
DEYKDFLDRRIVKDYTDYATVCFEHFGDKVKNWFTFNEPHSFCGLGYGTG
LHAPGARCSAGMTCVIPEEDALRNPYIVGHNLLLAHAETVDVYNKFYKGD
DGQIGMVLDVMAYEPYGNNFLDQQAQERAIDFHIGWFLEPMVRGDYPFSM
RSLVGDRLPFFTKSEQEKLVSSYDFVGINYYTSRFAKHIDISPEFIPKIN
TDDVYSNPEVNDSNGIPIGPDVGMYFIYSYPKGLKNILLRMKEKYGNPPI
YITENGTADMDGWGNPPMTDPLDDPLRIEYLQQHMTAIKEAIDLGRRTLR
GHFTWSLIDNFEWSLGYLSRFGIVYIDRNDGCKRIMKKSAKWLKEFNGAT
KKLNNKILGASSCCSGVTHGGGTA