Query (optional)   in Class  

GrainGenes Protein Report: FB919734_1.AA

Protein
FB919734_1.AA
Peptide
MGSASCISLRVMLVALAATAASAQLSSTFYDTSCPKALATIKSGVAAAVS
SDRRMGASLLRLHFHDCFGCDASVLLSGNEQNAAPNAGSLRGFSVIDNIK
TQVEAVCKQTVSCADILAVAARDSVVALGGPFLEQVPLGRRDSTSATGNT
GDLPAPTSSLAQLQAAFSKKNLDTTGMVALSGAHTIGQAQCKNFRSRIYG
GDTNINAAFATSLQANCPQATGGSGDSSLAPLDTKTPNAFDNSYYNNLLS
QKGLLHSDQVLFNNGTTDNTVRNFASSASAFTGAFTTAMIKMGNISPLTG
TQGQIRLSCSKVNS