Query (optional)   in Class  

GrainGenes Protein Report: FB919732_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
FB919732_1.protseq
Peptide
MGSASCISLRVMLVALAATAASAQLSSTFYDTSCPKALATIKSGVAAAVS
SDRRMGASLLRLHFHDCFGCDASVLLSGNEQNAAPNAGSLRGFSVIDNIK
TQVEAVCKQTVSCDDILAVAARDSVVALGGPSWTVPLGRRDSTSATGNTG
DLPAPTSSLAQLQAAFSKKNLDTTDMVALSGAHTIGQAQCKNFRSRIYGG
DTNINAAFATSLQANCPQATGGSGDSSLAPLDTKTPNAFDNSYYNNLLSQ
KGLLHSDQVLFNNGTTDNTVRNFASSASAFTGAFTTAMIKMGNISPLTGT
QGQIRLSCSKVNS
From Database
GenBank
Corresponding DNA
FB919732_1.cds