Query (optional)   in Class  

GrainGenes Protein Report: FB921573_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
FB921573_1.protseq
Peptide
MPPVLLLVLAASLVALPSCRSLPVQAPVTKDPATSLYTIPFHDGASLVLD
AAGPLVWSTCEAGQPPAGIPCGSPTCLLANAYPAPGCPAPTCGSDKPCTA
FPSNPVTGACAAGSLFHTSFVANTTDGTKPVSEVKVGVLAACAPSKLLAS
LPRGSTGVAGLANSGLALPAQVASAQKVANRFFLCLPTGGAGVAIFGGGP
LPWPQFTQSMPYTPLVTKGGSPAHYISLKSIKVDNTRVPVSEATGGVMLS
TRLPYALLRRDVYRPLVDAFTKALAAQPANGAPVARAVQPVAPFGVCYDT
KTLGNNLGGYAVPNVLLALDGGGEWAMTGKNSMVDVKPGTACVAFVEMKG
VEAGDGRAPAVILGGAQMEDFVLDFDMEKKRLGFTRLPHFTGCGSA
From Database
GenBank
Corresponding DNA
FB921573_1.cds