Query (optional)   in Class  

GrainGenes Protein Report: FJ032188_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
FJ032188_1.protseq
Peptide
GIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFSKVGFIFREHNAS
PGYYXGRYWTMWKLPM
From Database
GenBank
Corresponding DNA
FJ032188_1.cds