Query (optional)   in Class  

GrainGenes Protein Report: J04954_1.AA

Protein
J04954_1.AA
Peptide
MFLLHEYDIFWTFLIIASLIPILAFSISGLLAPVSEGPEKLSSYESGIEP
MGGAWVQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIF
VLILVVGLVYAWRKGALEWS