Query (optional)   in Class  

GrainGenes Protein Report: J05104_2.AA

Protein
J05104_2.AA
Peptide
MNWRSEHIWVELLKGSRKRSNFFWACILFLGSLGFLLVGTSSYLGKNIIS
ILPSQEILFFPQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEG
IVCIFRWGFPGIKRRVFLRFLMRDIQSIRI