Query (optional)   in Class  

GrainGenes Protein Report: J03897_1.AA

[ Printable Version ]  [ Submit comment/correction ]

Protein
J03897_1.AA
Peptide
GGPGCSSFDGFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDS
PAGVGLSYSKNVSDYETGDLKTATDSHTFLLKWFQLYPEFLSNPFYIAGE
SYAGVYVPTLSHEVVKGIQGGAKPTINFKGYMVGNGVCDTIFDGNALVPF
AHGMGLISDEIYQQASTSCHGNYWNATDGKCDTAISKIESLISGLNIYDI
LEPCYHSRSIKEVNLQNSKLPQSFKDLGTTNKPFPVRTRMLGRAWPLRAP
VKAGRVPSWQEVASGVPCMSDEVATAWLDNAAVRSAIHAQSVSAIGPWLL
CTDKLYFVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKS
LGYGVVDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAF
AFYSRWLAGSKL