Query (optional)   in Class  

GrainGenes Protein Report: J04954_2.AA

[ Printable Version ]  [ Submit comment/correction ]

Protein
J04954_2.AA
Peptide
MVLTEYLDKKKEGKDSIETVMNLIEFPLLDQTSSNSVISTTPNDLSNWSR
LSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGT
VTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLI
PVDVYLPGCPPKPEAVIDALTKLRKKISREIVEDRTLSQNKNRCFTTSHK
LYVRRSTHTGTYEQELLYQSPSTLDISSETFFKSKSSVPSYKLVN