Query (optional)   in Class  

GrainGenes Protein Report: J05486_1.protseq

[ Printable Version ]  [ Submit comment/correction ]

Protein
J05486_1.protseq
Peptide
MKNFLILALLSMAATMATAQFDPSEQYQPYPEQQQPILQQQLLLQQQQQM
LLQQQPLLQVLQQQLNPCRQFLVQQCSPVAAVSFLRSQILQQSSCQVMRQ
QCCRRLEQIPEQLRCPAIHSVVQAIIMQQQQQQFFQPQMQQQFFQPQMQQ
VTQGIFQPQMQQVTQGIFQTQMQGQIEGMRAFALQALPAMCDVYVPPHCP
VATTPLSGF
From Database
GenBank
Corresponding DNA
J05486_1.cds