Query (optional)   in Class  

GrainGenes Sequence Report: A26498_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A26498_1.cds
Peptide
MAAKMAKNVDKPLFTATFNVQASSADYATFIAGIRNKLRNPAHFSHNRPV
LPPVEPNVPPSRWFHVVLKASPTSAGLTLAIRADNIYLEGFKSSDGTWWE
LTPGLIPGATYVGFGGTYRDLLGDTDKLTNVALGRQQLADAVTALHGRTK
ADKPSGPKQQQAREAVTTLLLMVNEATRFQTVSGFVAGLLHPKAVEKKSG
KIGNEMKAQVNGWQDLSAALLKTDVKPPPGKSPAKFAPIEKMGVRTAVQA
ANTLGILLFVEVPGGLTVAKALELFHASGGK
Structure From Source
A26498
Source Exons
1846
Corresponding Protein
A26498_1.protseq
Gene Product
protein synthesis inhibitor
Remark
DB_xref: GI:1247342
DB_xref: SWISS-PROT:P22244
Feature: CDS: protein_id = 'CAA01823.1';
Gene: PSI
Codon Start
1