Query (optional)   in Class  

GrainGenes Sequence Report: A37987_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A37987_1.cds
Peptide
AVTTLLLMVNEATRFQTVSGFVAGLLHPKAVEKKSGKIGNEMKAQVNGWQ
DLSAALLKTDVKPPPGKSPAKFTPIEKMGVRTAEQAAATLGILLFVEVPG
GLTVAKALELFHASGGK
Structure From Source
A37987
Source Exons
1354
Corresponding Protein
A37987_1.protseq
Gene Product
protein synthesis inhibitor
Remark
DB_xref: GI:2294644
Feature: CDS: partial; standard_name = 'PSI'; protein_id = 'CAA02315.1';
Codon Start
1