Query (optional)   in Class  

GrainGenes Sequence Report: A48514_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A48514_1.cds
Peptide
MAASAATATATAAAVGAGEVISVHSLEQWTMQIEEANAAKKLVVIDFTAS
WCGPCRIMAPIFADLAKKFPAAVFLKVDVDELKPIAEQFSVEAMPTFLFM
KEGDVKDRVVGAIKEELTTKVGLHAAQ
Structure From Source
A48514
Source Exons
1384
Corresponding Protein
A48514_1.protseq
Remark
CDS note: unnamed protein product
DB_xref: GI:2302292
Feature: CDS: protein_id = 'CAA03108.1';
Codon Start
1