Query (optional)   in Class  

GrainGenes Sequence Report: A82382_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A82382_1.cds
Peptide
LPPGFRFHPTDEEVVTHYLTRKVLRESFSCQVITDVDLNKNEPWELPGLA
KMGEKEWFFFAHKGRKYPTGTRTNRATKKGYWKATGKDKEIFRGKGRDAV
LVGMKKTLVFYTGRAPSGGKTPWVMHEYRLEGELPHRLPRTAKDDWAVCR
VFNK
Structure From Source
A82382
Source Exons
1462
Corresponding Protein
A82382_1.protseq
Remark
CDS note: unnamed protein product
DB_xref: GI:6732156
Feature: CDS: protein_id = 'CAB69232.1';
Codon Start
1