Query (optional)   in Class  

GrainGenes Sequence Report: A82384_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A82384_1.cds
Peptide
MVMAAAERRDAEAELNLPPGFRFHPTDEELVADYLCARAAGRAPPVPIIA
ELDLYRFDPWELPERALFGAREWYFFTPRDRKYPNGSRPNRAAGGGYWKA
TGADRPVARAGRTVGIKKALVFYHGRPSAGVKTDWIMHEYRLAGADGRAA
KNGGTLRLDEWVLCRLYNKKNQWEKMQRQRQEEEAAAKAAASQSVSWGET
RTPESDVDNDPFPELDSLPEFQTANASILPKEEVQELGNDDWLMGISLDD
LQGPGSLMLPWDDSYAASFLSPVATMKMEQDVSPFFF
Structure From Source
A82384
Source Exons
1864
Corresponding Protein
A82384_1.protseq
Remark
CDS note: unnamed protein product
DB_xref: GI:6732158
Feature: CDS: protein_id = 'CAB69233.1';
Codon Start
1