Query (optional)   in Class  

GrainGenes Sequence Report: AB011670_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AB011670_1.cds
Peptide
MSAIKPPPPDRPPQAARLPSPSSSSSAAAAAKQGGTGSRGLLMGRYELGR
VLGKGTFAKVYHARHVQTGESVAIKVLDREKAVRSGLVSHIKREIAVLRR
VRHPNIVHLFEVMATKTKIYFVMELLVRGGELFSRVSKGRLKEDIARRYF
QHLISAVGFCHTRGVFHRDLKPENLLVDEAGNLKVSDFGLSAVAEPFQPE
GLLHTFCGTPAYVAPEVLARRGYEGAKADIWSCGVILFVLMAGYLPFHDQ
NLMAMYRKVYKGEFRCPRWFSKDLTSLIMRFLDTNPSTRITLPEVMESRW
FKKGFRPVKFYIEDDQLYNVIDAENDMLDLGLPDPLPQPLPPPPPSPSPQ
QVDGDDSGSESDASVVSCPATSSFEERHRLRGPLPRPASLNAFDIISFSR
GFNLSGLFEEKGDEVRFISGEPMPDIITKLEEIANVKSFAVRKKDWRVSL
EGTREGVKGPLTICAEIFELTPSLVVVEVKKKAGDKEEYDDFCNKELKPG
MQHLVHQMVPVPNTPTISELAERPSR
Structure From Source
AB011670
Source Exons
11581
Corresponding Protein
AB011670_1.protseq
Gene Product
wpk4 protein kinase
Remark
DB_xref: GI:3928519
Feature: CDS: protein_id = 'BAA34675.1';
Gene: wpk4
Codon Start
1