Query (optional)   in Class  

GrainGenes Sequence Report: AF155932_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF155932_1.cds
Peptide
IGVCYGVTGNNLPSRSDVVQLYRSKGITDMRIYFADGQALSALRNSGIGL
VMDIGNDQLGKIAGSASNAAAWVRDNVQRYQGLKIKYIVAGNEIQGGDTG
RIVPAIRNLNAALSAAGLGGIKVSTAIRFDAVANSFPPSAGVFAQSYMTD
VARLLASTGAPLLANIYPYFSYRDNPRDIQLNYATFRPGTTVRDSKSGLT
YTNLFDAMVDAVHAALEKAGAASVKVVVSESGWPKEGGTGASVDNARAYN
QGLIDHVGGGTPKKRGALETYVFAMFDENQKTGAGTEKHFGLFNPDKSPA
YPIRF
Structure From Source
AF155932
Source Exons
1918
Corresponding Protein
AF155932_1.protseq
Gene
Oglc13
Gene Product
1,3-beta glucanase
Remark
DB_xref: GI:8885873
Feature: CDS: protein_id = 'AAF80276.1'
Feature: CDS: protein_id = 'AAF80276.1';
Gene: Oglc13
Codon Start
1