Query (optional)   in Class  

GrainGenes Sequence Report: AF287723_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF287723_1.cds
Peptide
ADEEEGLRLPIPVDTLKPRLTYRVAGWISLGAARGTSHPVRIDLGVEDNG
NETLVECGAVCAKEGGWSEIMGAFRLRTEPRSAAVYVHGAPAGVDVKVMD
LRVYPVDHKARFRQLKDKTDKARKRDVILKLGTPAGAGAGAAASVRVVQL
DNAFPFGTCINTSVIQKPAFLDFFTNHFDWAVFENELKWYHTEVQQGQLN
YADADALLAFCDRLGKTVRGHCVFWSVDGDVQQWVKNLNKDQLRSAMQSR
LEGLVSRYAGRFKHYDVNNEMLHGRFFRDRLGDEDVPAYMFKEVARLDPE
PVLFVNDYNVECGNDPNATPEKYAEQVAWLQSCGAVVRGIGLQGHVQNPV
GEVICAALDRLAKTGVPIWFTELDVPEYDVGLRAKDLEVVLREAYAHPAV
EGIVFWGFMQGTMWRQNAWLVDADGTVNEAGQMFLNLQKEWKTDARGNFD
GDGNFKFRGFYGRYVVEVTTAKRKQMLNTFTVEKGDNTPVVVDLADA
Structure From Source
AF287723
Source Exons
11495
Corresponding Protein
AF287723_1.protseq
Gene Product
1,4-beta-D xylan xylanohydrolase
Remark
DB_xref: GI:14861193
Feature: CDS: protein_id = 'AAK73559.1';
Codon Start
2