Query (optional)   in Class  

GrainGenes Sequence Report: AF287726_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF287726_1.cds
Peptide
MASTTQDVNMDGNLAGCVPFGTGTTTLSVHIEEEMAMLPVTVAVGGNKPS
GRYVLVAGRADEEDGLRLPIPVDTLKPRLTYRVAGWISLGAARGTSHPVR
IDLGVEDNGNETLVECGAVCAKEGGWSEIMGAFRLRTEPRSAAVYVHGAP
AGVDVKVMDLRVYPVDHKARFRQLKDKTDKARKRDVILKLGTPAGAGAGA
AASVRVVQLDNAFPFGTCINTSVIQKPAFLDFFTNHLDWAVFENELKWYH
TEVQQGQLNYADADALLAFCDRLGKTVRGHCVFWSVDGDVQQWVKNLNKD
QLRSAMQSRLEGLVSRYAGRFKHYDVNNEMLHGRFFRDRLGDEDVPAYMF
KEVARLDPEPALFVNDYNVECGNDPNATPEKYAEQVAWLQSCGAVVRGIG
LQGHVQNPVGEVICAALDRLAKTGVPIWFTELDVPEYDVGLRAKDLEVVL
REAYAHPAVEGIVFWGFMQGTMWRQNAWLVDADGTVNEAGQMFLNLQKEW
KTDARGNFDGDGNFKFRGFYGRYVVEVTTAKGKQILKTFRVEKGDSTPLV
VDLADA
Structure From Source
AF287726
Source Exons
118
102623
7151845
Corresponding Protein
AF287726_1.protseq
Gene Product
1,4-beta-D xylan xylanohydrolase
Remark
DB_xref: GI:14861199
Feature: CDS: protein_id = 'AAK73562.1';
Codon Start
1