Query (optional)   in Class  

GrainGenes Sequence Report: AF327046_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF327046_1.cds
Peptide
MPGLTIGDTVPNLELDSTHGKIRIHDYVGNGYVILFSHPGDFTPVCTTEL
AAMANYAKEFEKRGVKLLGISCDDVQSHKEWTKDIEAYKPGSKVTYPIMA
DPDRSAIKQLNMVDPDEKDAEGQLPSRTLHIVGPDKKVKLSFLYPSCTGR
NMDEVVRAVDSLLTAAKHKVATPANWNPGECVVIAPGVSDDGAKKMFPQG
FETADLPSKKGYLRFTKV
Structure From Source
AF327046
Source Exons
1657
Corresponding Protein
AF327046_1.protseq
Gene Product
1-Cys peroxiredoxin
Remark
DB_xref: GI:12247762
Feature: CDS: protein_id = 'AAG50024.1';
Gene: PER1
Codon Start
1