Query (optional)   in Class  

GrainGenes Sequence Report: AF479037_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF479037_1.cds
Peptide
RDALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMW
FAEYLFLERSWAKDEKTLKSGLQRLKDFPRSFWLALFVEGTRFTPAKLLA
AQEYAISQGLTAPRNVLIPRTKGFVSAVSIMRDFVPAIYDTTVIIPEDSP
KPTMLRILQGQSSVVHVRIKRHSMSDMPNSDEDVSKWCKDIFVAXDALLG
QTYSNWSFDXENIPIXRPMXTFDXGPGXXMSPPIXGS
Structure From Source
AF479037
Source Exons
1714
Corresponding Protein
AF479037_1.protseq
Gene Product
1-acy1-glycerol-3-phosphate acyltransferase
Remark
CDS note: similar to Zea mays 1-acy1-glycerol-3-phosphate acyltransferase
DB_xref: GI:32400849
Feature: CDS: protein_id = 'AAP80656.1';
Codon Start
1