Query (optional)   in Class  

GrainGenes Sequence Report: AF480485_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF480485_1.cds
Peptide
MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM
DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR
IFWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSGQGQ
QGYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQGQQG
QQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPG
QGQQGQQPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSL
QQLGQGQSGYYPTSPQQPGQGQQLGQLQQPAQGQQPGQGQQGQQPGQGQQ
GQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQ
QGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQS
GQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQP
GYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQ
QPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPGQGQQGQQPGQGQQGQQP
GQGQQGQQPAQGQQGQQPGQGQQGQQPGQGQQGQQPGQGQQPGQGQPWYY
PTSPQESGQGQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQQPG
QGQQPGQWQQSGQGQHGYYPTSPQLSGQGQRPGQWLQPGQGQQGYYPTSP
QQSGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVS
VEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ
Structure From Source
AF480485
Source Exons
12508
Corresponding Protein
AF480485_1.protseq
Gene
1Dx2t
Gene Product
high molecular weight glutenin subunit
Remark
CDS note: HMW glutenin; seed storage protein
DB_xref: GI:19744394
Feature: CDS: protein_id = 'AAL96482.1';
Gene: 1Dx2t
Codon Start
1