Query (optional)   in Class  

GrainGenes Sequence Report: AF480486_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF480486_1.cds
Peptide
MAKRLVLFVAVVVALVALTVAEGEASEQLQCERELQELQERELKACQQVM
DQQLRDISPECHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQR
IFWGIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSGQGQ
QGYYPTSPQQPGQWQQPEQGQPGYYPTSPQQPGQLQQPAQGQQPGQGQQG
QQPGQGQPGYYPTSSQLQPGQLQQPAQGQQGQQPGQGQQGQQPGQGQQPG
QGQQGQQPGQGQQPGQGQQGQQLGQGQQGYYPTSLQQSGQGQPGYYPTSL
QQLGQGQSGYYPTSPQQPGQGQQPGQLQQPAQGQQPGQGQQGQQPGQGQQ
GQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYPTSSQQPTQSQQPGQGQ
QGQQVGQGQQAQQPGQGQQPGQGQPGYYPTSPQQSGQGQPGYYLTSPQQS
GQGQQPGQLQQSAQGQKGQQPGQGQQPGQGQQGQQPGQGQQGQQPGQGQP
GYYPTSPQQSGQGQQPGQWQQPGQGQPGYYPTSPLQPGQGQPGYDPTSPQ
QPGQGQQPGQLQQPAQGQQGQQLAQGQQGQQPAQVQQEQQPAQGQQGQQL
GQGQQGQQPGQGQQGQQPAQGQQGQQPGQGQQGQQPGQGQQPGQGQPWYY
PTSPQESGQGQQPGQWQQPGQGQPGYYLTSPLQLGQGQQGYYPTSLQQPG
QGQQPGQWQQSGQGQHEYYPTSPQLSGQGQRPGQWLQPGQGQQGYYPTSP
QQSGQGQQLGQWLQPGQGQQGYYPTSLQQTGQGQQSGQGQQGYYSSYHVS
VEHQAASLKVAKAQQLAAQLPAMCRLEGGDALSASQ
Structure From Source
AF480486
Source Exons
12511
Corresponding Protein
AF480486_1.protseq
Gene
1Dx2.1t
Gene Product
high molecular weight glutenin subunit
Remark
CDS note: HMW glutenin; seed storage protein
DB_xref: GI:19744396
Feature: CDS: protein_id = 'AAL96483.1';
Gene: 1Dx2.1t
Codon Start
1