Query (optional)   in Class  

GrainGenes Sequence Report: AF507044_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AF507044_1.cds
Peptide
MGLDLGAIALKYTGLAVSDHGSIVAINIFIALLCGCIVFGHLLEGNRWVN
ESTTALVLGLITGGVILICSKGVNSRILIFSEDIFFIYLLPPIIFNAGFQ
VKKKQFFRNFATIILFGAAGTLISFVIITFGAMGLFSKLGVGPLELGDYL
AIGAIFSATDSVCTLRVLNQDEAPLLYSLVFGEGVVNDATSVVLFNAIQN
IDINHFDVFVLLQFIGKFLYLFFTSTVLGVAAGLLSAYIIKKLCSARHST
DREVAIMILMAYLSYMLSMLLDLSGILTVFFCGIVMSHYTWHNVTESSRV
TTKHTFATLSLIAEIFLFLYVGMDALDIDKWKLASSSPKKPIALSAVILG
LVMVGRAAFVFPLSFLSNLSKKESHPKISFNQQVIIWWAGLMRGAVSIAL
AYNKFTTSGHTAVRVNAVMITSTIIVVLFSTMVFGLLTKPLINLLIPPRP
GTAADISSQSFLDPLTASLLGSDFDVGQLTPQTNLQYLLTMPTRSVHRVW
RKFDDKFMRPMFGGRGFVPFVPGSPIERSVHGPGLLGTVTEAEDRS
Structure From Source
AF507044
Source Exons
11641
Corresponding Protein
AF507044_1.protseq
Gene Product
Na+/H+ antiporter ENHX1
Na+/H+ antiporter NHX1
Remark
DB_xref: GI:33324365
Feature: CDS: protein_id = 'AAQ07963.1';
Feature: CDS: protein_id = 'AAQ07963.1'
Gene: NHX1
Codon Start
1