Query (optional)   in Class  

GrainGenes Sequence Report: AJ006098_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AJ006098_1.cds
Peptide
MAARPMLVVALLCAAAAAATAQQATNVRATYHYYRPAQNNWDLGAPAVSA
YCATWDASKPLSWRSKYGWTAFCGPAGAHGQASCGKCLQVTNPATGAQIT
ARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD
Structure From Source
AJ006098
Source Exons
1441
Corresponding Protein
AJ006098_1.protseq
Gene Product
wheatwin1
Remark
DB_xref: GI:3135957
DB_xref: SPTREMBL:O64392
Feature: CDS: protein_id = 'CAA06856.1';
Gene: wPR4a
Codon Start
1