Query (optional)   in Class  

GrainGenes Sequence Report: AJ564996_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AJ564996_1.cds
Peptide
MAQAWAFLLPVLVLGSYVTSLFLPTYITGPLCGGDGGGRSLFLCAQAPKD
QDPSPASTMYKTAFHFQPAKNWMNDPSGPMYFNGIYHEFYQYNLNGPIFG
DIVWGHSVSTDLVNWIGLEPALVRDTPSDIDGCWTGSVTILPGGKPIIIY
TGGDIDQNQAQNIAFPKNRSDPYLREWIKADNNPVLRPDEPGMNSIEFRD
PTTGWIGPDGLWRMAVGGELNGYSAALLYKSEDFLNWTKVDHPLYSHNGS
NMWECPDFFAVLPGNNAGLDLSAAIPQGAKHALKMSVDSVDKYMIGVYDL
HRDAFVPDNVVDDRRLWLRIDYGTFYASKSFFDSNKNRRIIWGWSRETDS
PSDDLAKGWAGLHTIPRTIWLAGDGKQLLQWPVEEIESLRTNEINHQGLE
LNKGDLFEIKEVDAFQADVEIGFELASIDDADPFDPSWLLDPEKHCGEAG
ASVPGGIGPFGLVILASDNMDEHTEVYFRVYKSQEKYMVLMCSDLRRSSL
RPDLEKPAYGGFFEFDLEKERKISLRTLIDRSAVESFGGGGRVCITSRVY
PAVLADVGSAHIYAFNNGSATVRVPQLSAWTMRKAQVNVEKGWSAI
Structure From Source
AJ564996
Source Exons
11791
Corresponding Protein
AJ564996_1.protseq
Gene
1-FEH w3
Gene Product
fructan 1-exohydrolase w3 precursor
Remark
DB_xref: GI:41581373
[ Show all 8 ]
Codon Start
1