Query (optional)   in Class  

GrainGenes Sequence Report: AL356014_29.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AL356014_29.cds
Peptide
MVRKEDVDFYCGFSRKELQSLCKKYNLPANRSSSDMAESLASYFEKNNLN
PVSFGVPGNQDSSATTSRAPAIRTWNVKRDSYGNKLDVPREDYVQGAVAR
EPGIILGNNTPYQERNGNDGLIDFTSAPPYMRKLNEKGPTANSKRADSRL
ENRMRDVDSGDNPSSSSFEFHVSLEEGISLSVDLNFNPSDWINSMRDEVN
VCDSMRRRKSPHSDLGITECKKQKSSGQDTDGHVRRESSLSPPMKDNAHL
PSDHHPNGERSLASSAIEPCNRIKESSDTCKEKSGLNLSIPDSSGPCQIA
SSCVESYSKSCCVNPVDLDCIIPPGKKLASESDMVAAEQNHSAGDLLVEI
PKNPSMESFQIVGNSSTVICPRGAGSELSSSEAEAYHSNQPCSPRKTSRS
STISSPEFIIDRESTSYSESFKFRCNGGKSLPPNTEEQEKSEVLSEQARS
E
Structure From Source
AL356014
Source Exons
142
1281102
13811481
15711673
18802014
Corresponding Protein
AL356014_29.protseq
Gene Product
hypothetical protein
Remark
CDS note: Contains Prokaryotic membrane lipoprotein lipid attachment site AA293-303
DB_xref: GI:7801693
DB_xref: UniProt/TrEMBL:Q9LX28
Feature: CDS: protein_id = 'CAB91613.1'; On complementary strand.
Gene: F25L23_290
Codon Start
1