Query (optional)   in Class  

GrainGenes Sequence Report: AM404177_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AM404177_1.cds
Peptide
MAAAAAAAAEASSADSRRYVVGYALAPKKQNSFIKPSLISRAAARGVDLV
PVDDARPLADQGPFDLVIHKLYGHDWRAQLQAFSARYPSVPVVDPPHAID
RLHNRISMLQVVSELDVPPGDADRRDTFGIPSQVVVYDAAALADSGLLAA
LRFPLIAKPLVADGSAKSHKMSLVYHREGLRKLRPPLVLQEFVNHGGVIF
KVYVVGGHVTCVKRHSLPDVSKEILEDAAAEGTISFSQVSNLPNQRTAEE
YYEDMRLEDAVMPPTDFVNEIAGGLRRALGLQLFNFDMIRDVRAGDRYLV
IDINYFPGYAKMPGYEIVLTDFFWDMVHKDDVALKEEEEQSNHAVVK
Structure From Source
AM404177
Source Exons
11044
Corresponding Protein
AM404177_1.protseq
Gene
ipk
Gene Product
inositol phosphate kinase
Remark
DB_xref: GI:117307087
Feature: CDS: function = 'inositol phosphate phosphorylation'; protein_id = 'CAL49035.1';
Codon Start
1