Query (optional)   in Class  

GrainGenes Sequence Report: AY174159_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AY174159_1.cds
Peptide
MAKRLVLFAAVVIALVALTTAGGEASRQLQCERELQESSLEACRQVVDQQ
LAGRLPWSTGLQMRCCQQLRGVSAKCRSVAASQVARQYEQTVVPPKGGSF
YPGETTPLQQLQQGIFWGTSSQTVQGYYPSVTSPRQGSYYPGQASPQQPG
QGQQPGKRQEPGQGQQWYYPTSLQQPGQGQQIGKGQQGYYPTSLQQPGQG
QQIGQGKQGYYPTSPQHTGQRQQPVQGQQPEQGQQPGQWQQGYYPTSPQQ
LGQGQQPGQWQQSGQGQQGHYPTSQQQPGQGQQGHYPASQQQPGQGQQGH
YPASQQQPGQGQQGHYPASQQQPGQGQQGHYPASLQQPGQGQQGHYPTSL
QQLGQGQQTGQPGQKQQLGQGQQTGHGQQPEQEQQQGQGQQGYYPTSLQQ
PGQGQQQGQGQQGYYPTSLQQPGQGQQGHYPASLQQPGQGQPGQRQQPGQ
GQHPEQGQQPGQGQQGYYPTSPQQPGQGQQLGQGQQGYYPTSPQQPGQGQ
QPGQGQQGHCPTSLQQTGQAQQSGQGQQIGQVQQPGQGQQGYYPTSLQQL
GQGQQSGQGQQSGQGHQPGQGQQSGQEQQGYDGPYHVSAEQQAASPMVAK
AQQPATQLPTVCRMEGGDALSASQ
Structure From Source
AY174159
Source Exons
11875
Corresponding Protein
AY174159_1.protseq
Gene
1Dy13t
Gene Product
high molecular weight glutenin subunit
Remark
CDS note: seed storage protein
DB_xref: GI:27652600
Feature: CDS: protein_id = 'AAO17799.1';
Gene: 1Dy13t
Codon Start
1