Query (optional)   in Class  

GrainGenes Sequence Report: AY277385_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AY277385_1.cds
Peptide
MSRQDVASMFVVALVVGAFASLPTYVQSIGVCYGVTGNNLPSRSDVVQLY
RSKGITDMRIYFADGQALSALRNSGIGLVMDIGNDQLGKIAGSASNAAAW
VRDNVQRYQGLKIKYIVAGNEIQGGDTGRIVPAIRNLNAALSAAGLGGIK
VSTAIRFDAVASSFPPSAGVFAQSYMTDVARLLASTGAPLLANIYPYFSY
RDNPRDIQLNYATFRPGTTVRDSKSGLTYTNLFDAMVDAVHAALEKAGAP
GVKVVVSESGWPKTGGTGASTDNARAYNQGLIDHVGGGTPKKRGALETYV
FAMFDENQKTGAGTEKHFGLFNPDKSPAYPIRF
Structure From Source
AY277385
Source Exons
173
12912219
Corresponding Protein
AY277385_1.protseq
Gene
Oglc13
Gene Product
1,3-beta glucanase
Remark
DB_xref: GI:30692089
Feature: CDS: protein_id = 'AAP33176.1'
Feature: CDS: protein_id = 'AAP33176.1';
Gene: Oglc13
Codon Start
1